- DUS4L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91854
- Unconjugated
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Human
- DUS4L
- DUS4, PP35
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: ELVQDMVKQV RNQVETPGFS VSIKIRIHDD LKRTVDLCQK AEATGVSWIT VHGRTAEERH QPVHYDSIKI IKENMSIPVI ANGD
- dihydrouridine synthase 4 like
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
Specifications/Features
Available conjugates: Unconjugated